×

Added to cart successfully !

[Tyr0]-┒-CGRP, [Tyr0]-┒-CGRP, rat

E-PP-0315

Size:   Price:   Inquire
Qty:
- +
Lead Time:   Inquiry

Product Details

Sequence (One Letter Code) YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: C2-C7)
Sequence (Three Letter Code) Tyr-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2 (Disulfide bridge: Cys2-Cys7)
Formula C171H271N51O54 S2
Molecular Weight 3969.5
Form Lyophilized powder
Purity > 95%
Storage Shipped at 4℃. Stored at -20℃ for one year.
Note For research use only.
If you have any question about the products, please contact us by clicking the message button near the home button of your phone, we will reply you in 12 hours.