×

Added to cart successfully !

β-Defensin-3, human

E-PP-0477

Size:   Price:   Inquire
Qty:
- +
Lead Time:   Inquiry

Product Details

Sequence (One Letter Code) GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: C11-C40, C18-C33, C23-C41)
Sequence (Three Letter Code) Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys (Disulfide bridges: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41)
Formula C216H371N75O59S6
Molecular Weight 5155.22
Form Lyophilized powder
Purity > 95%
Storage Shipped at 4℃. Stored at -20℃ for one year.
Note For research use only.
If you have any question about the products, please contact us by clicking the message button near the home button of your phone, we will reply you in 12 hours.