×

Added to cart successfully !

Calcitonin, human

E-PP-0900

Size:   Price:   Inquire
Qty:
- +
Lead Time:   Inquiry

Product Details

Sequence (One Letter Code) CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: C1-C7)
Sequence (Three Letter Code) Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Formula C151H226N40O45S3
Molecular Weight 3417.87
Form Lyophilized powder
Purity > 95%
Storage Shipped at 4℃. Stored at -20℃ for one year.
Note For research use only.
If you have any question about the products, please contact us by clicking the message button near the home button of your phone, we will reply you in 12 hours.