×

Added to cart successfully !

Neuropeptide EI-Gly-Arg-Arg-MCH, human, mouse, rat

E-PP-1605

Size:   Price:   Inquire
Qty:
- +
Lead Time:   Inquiry

Product Details

Sequence (One Letter Code) EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV (Disulfide bridge: C23-C32)
Sequence (Three Letter Code) Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-Gly-Arg-Arg-Asp-Phe-Asp-Met-Leu-Arg-Cys-Met-Leu-Gly-Arg-Val-Tyr-Arg-Pro-Cys-Trp-Gln-Val (Disulfide bridge: C23-C32)
Formula C182H282N54O52S4
Molecular Weight 4186.86
Form Lyophilized powder
Purity > 95%
Storage Shipped at 4℃. Stored at -20℃ for one year.
Note For research use only.
If you have any question about the products, please contact us by clicking the message button near the home button of your phone, we will reply you in 12 hours.