×

Added to cart successfully !

FOXO4 D-Retro-Inverso(DRI) peptide

E-PP-2108

Size:   Price:   Inquire
Qty:
- +
Lead Time:   Inquiry

Product Details

Sequence (One Letter Code) ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all D amino acid)
Sequence (Three Letter Code) D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly
Formula C228H388N86O64
Molecular Weight 5358.05
Form Lyophilized powder
Purity > 95%
Storage Shipped at 4℃. Stored at -20℃ for one year.
Note For research use only.
If you have any question about the products, please contact us by clicking the message button near the home button of your phone, we will reply you in 12 hours.